Recombinant Vaccinia virus Truncated plaque-size/host range protein(PS/HR)

Specification
Organism Vaccinia virus (strain LC16m8) (VACV)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P24284
Gene Names PS/HR
Alternative Names Protein B5
Expression Region Full Length of Mature Protein(18-92aa )
Molecular Weight 10.6 kDa
Protein Sequence YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYK
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Regulation of plaque size and host range. In this strain the truncated ps/hr protein is probably not functional.
Involvement in Disease
Subcellular Location
Protein Families Receptors of complement activation (RCA) family
Tissue Specificity PS/HR
QC Data
Please contact us for specific QC data.
$392.00
In stock
SKU
EB-PYVAF335153

Recombinant Vaccinia virus Truncated plaque-size/host range protein(PS/HR)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Vaccinia virus Truncated plaque-size/host range protein(PS/HR)
Copyright © 2021-present Echo Biosystems. All rights reserved.