Specification
Organism | Vaccinia virus (strain LC16m8) (VACV) |
Expression Host | Yeast |
Tag Info | N-terminal 6xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P24284 |
Gene Names | PS/HR |
Alternative Names | Protein B5 |
Expression Region | Full Length of Mature Protein(18-92aa ) |
Molecular Weight | 10.6 kDa |
Protein Sequence | YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYK |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Regulation of plaque size and host range. In this strain the truncated ps/hr protein is probably not functional. |
Involvement in Disease | |
Subcellular Location | |
Protein Families | Receptors of complement activation (RCA) family |
Tissue Specificity | PS/HR |
QC Data