Recombinant Vaccinia virus Protein L1(VACWR088),partial

Specification
Organism Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P07612
Gene Names VACWR088
Alternative Names Virion membrane protein M25
Expression Region Partial(2-183aa )
Molecular Weight 21.3 kDa
Protein Sequence GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPKQVAGTG
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Envelope protein which probably plays a role in virus entry into the host cell. Is probably involved in the virus attachment to the host cell surface and associates with the entry/fusion complex. Needed for fusion and penetration of the virus core into host cell.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity VACWR088
QC Data
Please contact us for specific QC data.
$392.00
In stock
SKU
EB-PYAI13621906

Recombinant Vaccinia virus Protein L1(VACWR088),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Vaccinia virus Protein L1(VACWR088),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.