Specification
| Organism | Rattus norvegicus (Rat) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q8VI82 |
| Gene Names | Fgf23 |
| Alternative Names | Fgf23Fibroblast growth factor 23; FGF-23 |
| Expression Region | Full Length of Mature Protein(25-251aa ) |
| Molecular Weight | 27.5 kDa |
| Protein Sequence | YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Regulator of phosphate homeostasis . Inhibits renal tubular phosphate transport by reducing SLC34A1 levels . Regulator of vitamin-D metabolism . Negatively regulates osteoblasts differentiation and matrix mineralization . Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL. |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | Heparin-binding growth factors family |
| Tissue Specificity | Fgf23 |
QC Data