Recombinant Rat Brain-derived neurotrophic factor(Bdnf),partial

Specification
Organism Rattus norvegicus (Rat)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P23363
Gene Names Bdnf
Alternative Names BdnfBrain-derived neurotrophic factor; BDNF) [Cleaved into: BDNF precursor form; ProBDNF)]
Expression Region Partial(136-243aa )
Molecular Weight 16.3 kDa
Protein Sequence RRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTL
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systs. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS .
Involvement in Disease
Subcellular Location Secreted
Protein Families NGF-beta family
Tissue Specificity Bdnf
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PR94r166519

Recombinant Rat Brain-derived neurotrophic factor(Bdnf),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Rat Brain-derived neurotrophic factor(Bdnf),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.