Specification
| Organism | Legionella pneumophila (strain Corby) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | A5IGB8 |
| Gene Names | mip |
| Alternative Names | Macrophage infectivity potentiator Peptidyl-prolyl cis-trans isomerase Short name: PPIase |
| Expression Region | Full Length of Mature Protein(21-233aa ) |
| Molecular Weight | 24.8 kDa |
| Protein Sequence | ATDATSLATDKDKLSYSIGADLGKNFKNQGIDVNPEAMAKGMQDAMSGAQLALTEQQMKDVLNKFQKDLMAKRTAEFNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINAGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKSS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Essential virulence factor associated with macrophage infectivity. Exhibits PPIase activity. |
| Involvement in Disease | |
| Subcellular Location | Cell outer membrane |
| Protein Families | FKBP-type PPIase family |
| Tissue Specificity | mip |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |