Specification
| Organism | Influenza A virus (strain A/USA:Phila/1935 H1N1) |
| Expression Host | in vitro E.coli expression system |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | A4GCM0 |
| Gene Names | M |
| Alternative Names | M; M2; Matrix protein 2; Proton channel protein M2 |
| Expression Region | Full Length(1-97aa ) |
| Molecular Weight | 15.1 kDa |
| Protein Sequence | MSLLTEVETPIRNEWGCRCNGSSDPLVIAASIIGILHLILWILDRLLFKCIYRRFKYGLKRGPSTEGVPESMREEYRKEQQSAVDADDGHFVNIEPE |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Forms a proton-selective ion channel that is necessary for the efficient release of the viral genome during virus entry. After attaching to the cell surface, the virion enters the cell by endocytosis. Acidification of the endosome triggers M2 ion channel activity. The influx of protons into virion interior is believed to disrupt interactions between the viral ribonucleoprotein (RNP), matrix protein 1 (M1), and lipid bilayers, thereby freeing the viral genome from interaction with viral proteins and enabling RNA segments to migrate to the host cell nucleus, where influenza virus RNA transcription and replication occur. Also plays a role in viral proteins secretory pathway. Elevates the intravesicular pH of normally acidic compartments, such as trans-Golgi network, preventing newly formed hemagglutinin from premature switching to the fusion-active conformation (By similarity). |
| Involvement in Disease | |
| Subcellular Location | Virion membrane, Host apical cell membrane, Single-pass type III membrane protein |
| Protein Families | Influenza viruses matrix protein M2 family |
| Tissue Specificity | M |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |