Recombinant Human VPS37B protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens VPS37B subunit of ESCRT-I (VPS37B) (NM_024667).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9H9H4
Entry Name VP37B_HUMAN
Gene Names VPS37B
Alternative Gene Names
Alternative Protein Names Vacuolar protein sorting-associated protein 37B (hVps37B) (ESCRT-I complex subunit VPS37B)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 285
Molecular Weight(Da) 31307
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MAGAGSEARFAGLSLVQLNELLEDEGQLTEMVQKMEETQNVQLNKEMTLASNRSLAEGNLLYQPQLDTLKARLTQKYQELQVLFEAYQIKKTKLDRQSSSASLETLLALLQAEGAKIEEDTENMAEKFLDGELPLDSFIDVYQSKRKLAHMRRVKIEKLQEMVLKGQRLPQALAPLPPRLPELAPTAPLPYPAPEASGPPAVAPRRIPPPPPPVPAGRLATPFTAAMSSGQAVPYPGLQCPPLPPRVGLPTQQGFSSQFVSPYPPPLPQRPPPRLPPHQPGFILQ
Background
Function FUNCTION: Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies. May be involved in cell growth and differentiation. {ECO:0000269|PubMed:15218037}.
Pathway
Protein Families VPS37 family
Tissue Specificity Widely expressed. Expressed in macrophages and lymphocytes. {ECO:0000269|PubMed:15218037}.
QC Data
Please contact us for specific QC data.
$389.00
In stock
SKU
EB-EPE8265225

Recombinant Human VPS37B protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human VPS37B protein
Copyright © 2021-present Echo Biosystems. All rights reserved.