Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens T cell leukemia/lymphoma 1A (TCL1A), transcript variant 1 (NM_021966). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P56279 |
| Entry Name | TCL1A_HUMAN |
| Gene Names | TCL1A TCL1 |
| Alternative Gene Names | TCL1 |
| Alternative Protein Names | T-cell leukemia/lymphoma protein 1A (Oncogene TCL-1) (Oncogene TCL1) (Protein p14 TCL1) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 114 |
| Molecular Weight(Da) | 13460 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD |
Background
| Function | FUNCTION: Enhances the phosphorylation and activation of AKT1, AKT2 and AKT3. Promotes nuclear translocation of AKT1. Enhances cell proliferation, stabilizes mitochondrial membrane potential and promotes cell survival. {ECO:0000269|PubMed:10716693, ECO:0000269|PubMed:10983986, ECO:0000269|PubMed:11707444, ECO:0000269|PubMed:11839817}. |
| Pathway | |
| Protein Families | TCL1 family |
| Tissue Specificity | Restricted in the T-cell lineage to immature thymocytes and activated peripheral lymphocytes. Preferentially expressed early in T- and B-lymphocyte differentiation. |
QC Data
| Please contact us for specific QC data. |