Recombinant Human SMNDC1 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens survival motor neuron domain containing 1 (SMNDC1) (NM_005871).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID O75940
Entry Name SPF30_HUMAN
Gene Names SMNDC1 SMNR SPF30
Alternative Gene Names SMNR SPF30
Alternative Protein Names Survival of motor neuron-related-splicing factor 30 (30 kDa splicing factor SMNrp) (SMN-related protein) (Survival motor neuron domain-containing protein 1)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 238
Molecular Weight(Da) 26711
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ
Background
Function FUNCTION: Involved in spliceosome assembly. {ECO:0000269|PubMed:11331295, ECO:0000269|PubMed:11331595, ECO:0000269|PubMed:9817934}.
Pathway
Protein Families SMN family
Tissue Specificity Detected at intermediate levels in skeletal muscle, and at low levels in heart and pancreas. {ECO:0000269|PubMed:9817934}.
QC Data
Please contact us for specific QC data.
$389.00
In stock
SKU
EB-EPE8263805

Recombinant Human SMNDC1 protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human SMNDC1 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.