Specification
| Organism | Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P06484 |
| Gene Names | gG US4 |
| Alternative Names | gG-1 |
| Expression Region | Partial(25-189aa ) |
| Molecular Weight | 33.4 kDa |
| Protein Sequence | VPTNVSSTTQPQLQTTGRPSHEAPNMTQTGTTDSPTAISLTTPDHTPPMPSIGLEEEEEEEGAGDGEHLEGGDGTRDTLPQSPGPAFPLAEDVEKDKPNRPVVPSPDPNNSPARPETSRPKTPPTIIGPLATRPTTRLTSKGRPLVPTPQHTPLFSFLTASPALD |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Chokine-binding protein that inhibits neutrophils' chotaxis. |
| Involvement in Disease | |
| Subcellular Location | Virion membrane, Single-pass type I membrane protein |
| Protein Families | Alphaherpesvirinae glycoprotein G family |
| Tissue Specificity | gG US4 |
QC Data