Specification
| Organism | Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1) |
| Expression Host | in vitro E.coli expression system |
| Tag Info | N-terminal 10xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P06484 |
| Gene Names | gG |
| Alternative Names | gG-1 |
| Expression Region | Full Length of Mature Protein(25-238aa ) |
| Molecular Weight | 28.8 kDa |
| Protein Sequence | VPTNVSSTTQPQLQTTGRPSHEAPNMTQTGTTDSPTAISLTTPDHTPPMPSIGLEEEEEEEGAGDGEHLEGGDGTRDTLPQSPGPAFPLAEDVEKDKPNRPVVPSPDPNNSPARPETSRPKTPPTIIGPLATRPTTRLTSKGRPLVPTPQHTPLFSFLTASPALDTLFVVSTVIHTLSFLCIGAMATHLCGGWSRRGRRTHPSVRYVCLPSERG |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Chemokine-binding protein that inhibits neutrophils' chemotaxis. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | gG |
QC Data