Specification
| Organism | Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1) |
| Expression Host | E.coli |
| Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P04487 |
| Gene Names | US11 |
| Alternative Names | Vmw21 |
| Expression Region | Full Length(1-161aa ) |
| Molecular Weight | 25.2 kDa |
| Protein Sequence | MSQTQPPAPVGPGDPDVYLKGVPSAGMHPRGVHAPRGHPRMISGPPQRGDNDQAAGQCGDSGLLRVGADTTISKPSEAVRPPTIPRTPRVPREPRVPRPPREPREPRVPRAPRDPRVPRDPRDPRQPRSPREPRSPREPRSPREPRTPRTPREPRTARGSV |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Plays a role in the inhibition of host immune response. Participates in the inhibition of host autophagy by interacting with and inhibiting host PKR/EIF2AK2. This interaction also prevents the interferon-induced shut down of protein synthesis following viral infection. Downmodulates the host RLR signaling pathway via direct interaction with host DDX58 and IFIH1. Associates with endogenous HSP90 to disrupt the HSP90-TBK1 complex and induces destabilization of host TBK1 through a proteasome-dependent pathway. May also participate in nuclear egress of viral particles through interactions with host NCL and regulation of the viral UL34 mRNA. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | US11 |
QC Data