Specification
| Organism | Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P12824 |
| Gene Names | gH |
| Alternative Names | gH; UL75; Envelope glycoprotein H; gH |
| Expression Region | Partial(24-195aa ) |
| Molecular Weight | 35.8 kDa |
| Protein Sequence | RYGADAASEALDPHAFHLLLNTYGRPIRFLRENTTQCTYNSSLRNSTVVRENAISFNFFQSYNQYYVFHMPRCLFAGPLAEQFLNQVDLTETLERYQQRLNTYALVSKDLASYRSFSQQLKAQDSLGQQPTTVPPPIDLSIPHVWMPPQTTPHDWKGSHTTSGLHRPHFNQT |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma mbranes leading to virus entry into the host cell. Mbrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL . Fusion of with fibroblasts requires the additional receptor-binding protein gO, which forms a complex with gH/gL. |
| Involvement in Disease | |
| Subcellular Location | Virion membrane, Single-pass type I membrane protein, Host cell membrane, Single-pass type I membrane protein, Host endosome membrane, Single-pass type I membrane protein |
| Protein Families | Herpesviridae glycoprotein H family |
| Tissue Specificity | gH |
QC Data