Specification
| Organism | Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P06725 |
| Gene Names | UL83 |
| Alternative Names | 65KDA matrix phosphoprotein Phosphoprotein UL83 Tegument protein UL83 |
| Expression Region | Partial(351-480aa ) |
| Molecular Weight | 18.2 kDa |
| Protein Sequence | FDIDLLLQRGPQYSEHPTFTSQYRIQGKLEYRHTWDRHDEGAAQGDDDVWTSGSDSDEELVTTERKTPRVTGGGAMAGASTSAGRKRKSASSATACTSGVMTRGRLKAESTVAPEEDTDEDSDNEIHNPA |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Counteracts the host antiviral immune response when activated and phosphorylated, by preventing IRF3 from entering the nucleus. Also participates in the transactivation of viral major immediate-early genes by the recruitment of host IFI16 to the promoters pf these genes. |
| Involvement in Disease | |
| Subcellular Location | Virion tegument, Host nucleus, Host cytoplasm |
| Protein Families | Herpesviridae pp65 family |
| Tissue Specificity | UL83 |
QC Data