Recombinant Human Carboxypeptidase N catalytic chain(CPN1)

Specification
Description Recombinant protein from Homo sapiens Carboxypeptidase N catalytic chain(CPN1).
Organism Homo sapiens (Human)
Expression Host Baculovirus
Tag Info N-terminal His-tagged OR Tag-Free.
Purity Greater than 85% by SDS-PAGE gel
Uniprot ID P15169
Gene Names CPN1
Alternative Names ACBP; Anaphylatoxin inactivator; Arginine carboxypeptidase; Carboxypeptidase N catalytic chain; Carboxypeptidase N polypeptide 1 50 kD; Carboxypeptidase N polypeptide 1; Carboxypeptidase N small subunit; Carboxypeptidase N subunit 1; CBPN_HUMAN; CPN; CPN1; Kininase 1; Kininase-1; Kininase1; Lysine carboxypeptidase; Plasma carboxypeptidase B; SCPN; Serum carboxypeptidase N
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Expression Region 21-458aa
Sequence Info Full Length of Mature Protein
Molecular Weight 57.5 KDa
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
VTFRHHRYDDLVRTLYKVQNECPGITRVYSIGRSVEGRHLYVLEFSDHPGIHEPLEPEVKYVGNMHGNEALGRELMLQLSEFLCEEFRNRNQRIVQLIQDTRIHILPSMNPDGYEVAAAQGPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPNHHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDKSFEHRVRGVRRTASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPPEEELQREWLGNREALIQFLEQVHQGIKGMVLDENYNNLANAVISVSGINHDVTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKRSIPQVSPVRRAPSRRHGVRAKVQPQARKKEMEMRQLQRGPA
Background
Function Protects the body from potent vasoactive and inflammatory peptides containing C-terminal Arg or Lys which are released into the circulation.
QC Data
Please contact us for specific QC data.
$1,568.00
In stock
SKU
EB-PB8HU6023

Recombinant Human Carboxypeptidase N catalytic chain(CPN1)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Carboxypeptidase N catalytic chain(CPN1)
Copyright © 2021-present Echo Biosystems. All rights reserved.