Recombinant Herpes simplex virus type 2 ICP47 protein(US12)

Specification
Organism Herpes simplex virus type 2 (strain SA8) (Simian agent 8)
Expression Host E.coli
Tag Info N-terminal 6xHis-KSI-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P60504
Gene Names US12
Alternative Names Immediate-early protein IE12 (Immediate-early-5) (Infected cell protein 47) (US12 protein) (Vmw12)
Expression Region Full Length(1-78aa )
Molecular Weight 23.9 kDa
Protein Sequence MSSLYLATVDAFLRNPHTRHRTCADLRRELDAYADEERREAAKAIAHPDRPLLAPPSAPPNHSHLAARETAPPPAATP
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Plays a role in the inhibition of host immune response. Binds specifically to transporters associated with antigen processing, thereby blocking peptide-binding and translocation by TAP as well as subsequent loading of peptides onto MHC class I molecules. Empty MHC I molecules are retained in the endoplasmic reticulum and ultimately directed to proteasomal degradation. In consequence, infected cells are masked for immune recognition by cytotoxic T-lymphocytes.
Involvement in Disease
Subcellular Location Host cytoplasm, Host nucleus
Protein Families Herpesviridae US12 family
Tissue Specificity US12
QC Data
Please contact us for specific QC data.
$349.00
In stock
SKU
EB-PEHGH353176

Recombinant Herpes simplex virus type 2 ICP47 protein(US12)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Herpes simplex virus type 2 ICP47 protein(US12)
Copyright © 2021-present Echo Biosystems. All rights reserved.