Specification
Organism | Herpes simplex virus type 2 (strain SA8) (Simian agent 8) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-KSI-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P60504 |
Gene Names | US12 |
Alternative Names | Immediate-early protein IE12 (Immediate-early-5) (Infected cell protein 47) (US12 protein) (Vmw12) |
Expression Region | Full Length(1-78aa ) |
Molecular Weight | 23.9 kDa |
Protein Sequence | MSSLYLATVDAFLRNPHTRHRTCADLRRELDAYADEERREAAKAIAHPDRPLLAPPSAPPNHSHLAARETAPPPAATP |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Plays a role in the inhibition of host immune response. Binds specifically to transporters associated with antigen processing, thereby blocking peptide-binding and translocation by TAP as well as subsequent loading of peptides onto MHC class I molecules. Empty MHC I molecules are retained in the endoplasmic reticulum and ultimately directed to proteasomal degradation. In consequence, infected cells are masked for immune recognition by cytotoxic T-lymphocytes. |
Involvement in Disease | |
Subcellular Location | Host cytoplasm, Host nucleus |
Protein Families | Herpesviridae US12 family |
Tissue Specificity | US12 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |