Specification
| Organism | Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) |
| Expression Host | E.coli |
| Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P12977 |
| Gene Names | EBNA3 |
| Alternative Names | Epstein-Barr nuclear antigen 3A (EBNA-3A) (EBV nuclear antigen 3A) |
| Expression Region | Partial(1-138aa ) |
| Molecular Weight | 22.2 kDa |
| Protein Sequence | MDKDRPGPPALDDNMEEEVPSTSVVQEQVSAGDWENVLIELSDSSSEKEAEDAHLEPAQKGTKRKRVDHDAGGSAPARPMLPPQPDLPGREAILRRFPLDLRTLLQAIGAAATRIDTRAIDQFFGSQISNTEMYIMYA |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Plays an essential role for activation and immortalization of human B-cells. Represses transcription of viral promoters TP1 and Cp through interaction with host RBPJ, and inhibits EBNA2-mediated activation of these promoters. Since Cp is the promoter for all EBNA mRNAs, EBNA3A probably contributes to a negative autoregulatory control loop. |
| Involvement in Disease | |
| Subcellular Location | Host nucleus matrix |
| Protein Families | Herpesviridae EBNA-3 family |
| Tissue Specificity | EBNA3 |
QC Data