Recombinant Epstein-Barr virus DNA polymerase catalytic subunit (BALF5) ,partial

Specification
Organism Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P03198
Gene Names BALF5
Alternative Names BALF5DNA polymerase catalytic subunit; EC 2.7.7.7
Expression Region Partial(1-210aa )
Molecular Weight 39.2 kDa
Protein Sequence MSGGLFYNPFLRPNKGLLKKPDKEYLRLIPKCFQTPGAAGVVDVRGPQPPLCFYQDSLTVVGGDEDGKGMWWRQRAQEGTARPEADTHGSPLDFHVYDILETVYTHEKCAVIPSDKQGYVVPCGIVIKLLGRRKADGASVCVNVFGQQAYFYASAPQGLDVEFAVLSALKASTFDRRTPCRVSVEKVTRRSIMGYGNHAGDYHKITLSHP
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Replicates viral genomic DNA in the late phase of lytic infection, producing long concateric DNA. The replication complex is composed of six viral proteins: the DNA polymerase, processivity factor, primase, primase-associated factor, helicase, and ssDNA-binding protein.
Involvement in Disease
Subcellular Location Host nucleus
Protein Families DNA polymerase type-B family
Tissue Specificity BALF5
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEEFA356103

Recombinant Epstein-Barr virus DNA polymerase catalytic subunit (BALF5) ,partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Epstein-Barr virus DNA polymerase catalytic subunit (BALF5) ,partial
Copyright © 2021-present Echo Biosystems. All rights reserved.