Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens vesicle associated membrane protein 1 (VAMP1), transcript variant 1 (NM_014231). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P23763 |
| Entry Name | VAMP1_HUMAN |
| Gene Names | VAMP1 SYB1 |
| Alternative Gene Names | SYB1 |
| Alternative Protein Names | Vesicle-associated membrane protein 1 (VAMP-1) (Synaptobrevin-1) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 118 |
| Molecular Weight(Da) | 12902 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT |
Background
| Function | FUNCTION: Involved in the targeting and/or fusion of transport vesicles to their target membrane. |
| Pathway | |
| Protein Families | Synaptobrevin family |
| Tissue Specificity | Nervous system, skeletal muscle and adipose tissue. |
QC Data
| Please contact us for specific QC data. |