Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens serine peptidase inhibitor, Kazal type 1 (SPINK1) (NM_003122). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P00995 |
| Entry Name | ISK1_HUMAN |
| Gene Names | SPINK1 PSTI |
| Alternative Gene Names | PSTI |
| Alternative Protein Names | Serine protease inhibitor Kazal-type 1 (Pancreatic secretory trypsin inhibitor) (Tumor-associated trypsin inhibitor) (TATI) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 79 |
| Molecular Weight(Da) | 8507 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MKVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC |
Background
| Function | FUNCTION: Serine protease inhibitor which exhibits anti-trypsin activity (PubMed:7142173). In the pancreas, protects against trypsin-catalyzed premature activation of zymogens (By similarity). {ECO:0000250|UniProtKB:P09036, ECO:0000269|PubMed:7142173}.; FUNCTION: In the male reproductive tract, binds to sperm heads where it modulates sperm capacitance by inhibiting calcium uptake and nitrogen oxide (NO) production. {ECO:0000250|UniProtKB:P09036}. |
| Pathway | |
| Protein Families | |
| Tissue Specificity |
QC Data
| Please contact us for specific QC data. |