Recombinant Human SFTPC protein

Specification
Description Recombinant protein from the full-length sequence of homo sapiens surfactant protein C (SFTPC), transcript variant 1 (NM_003018).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID P11686
Entry Name PSPC_HUMAN
Gene Names SFTPC SFTP2
Alternative Gene Names SFTP2
Alternative Protein Names Pulmonary surfactant-associated protein C (SP-C) (Pulmonary surfactant-associated proteolipid SPL(Val)) (SP5)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 197
Molecular Weight(Da) 21053
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGLHMSQKHTEMVLEMSIGAPEAQQRLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALNRKVHNFQMECSLQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVNTLCGEVPLYYI
Background
Function FUNCTION: Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces.
Pathway
Protein Families
Tissue Specificity
QC Data
Please contact us for specific QC data.
$389.00
In stock
SKU
EB-EPE8510766

Recombinant Human SFTPC protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human SFTPC protein
Copyright © 2021-present Echo Biosystems. All rights reserved.