Recombinant Human CEBPE protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens CCAAT enhancer binding protein epsilon (CEBPE) (NM_001805).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q15744
Entry Name CEBPE_HUMAN
Gene Names CEBPE
Alternative Gene Names
Alternative Protein Names CCAAT/enhancer-binding protein epsilon (C/EBP epsilon)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 281
Molecular Weight(Da) 30603
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS
Background
Function FUNCTION: Transcriptional activator (PubMed:26019275). C/EBP are DNA-binding proteins that recognize two different motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers. Required for the promyelocyte-myelocyte transition in myeloid differentiation (PubMed:10359588). {ECO:0000269|PubMed:10359588, ECO:0000269|PubMed:26019275}.
Pathway
Protein Families BZIP family, C/EBP subfamily
Tissue Specificity Strongest expression occurs in promyelocyte and late-myeloblast-like cell lines. {ECO:0000269|PubMed:9032264}.
QC Data
Please contact us for specific QC data.
$389.00
In stock
SKU
EB-EPE8272805

Recombinant Human CEBPE protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human CEBPE protein
Copyright © 2021-present Echo Biosystems. All rights reserved.