Recombinant Human Novel Coronavirus Spike glycoprotein(S) (N501Y),partial (Active)

Specification
Target Name S
Uniprot ID P0DTC2
Organism SARS-CoV-2
Expression Host Mammalian cell
Tag Info C-terminal 10xHis-tagged
Sequence Desciption Partial
Sequence RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
Molecular Weight 27.9 kDa
Purity Greater than 90% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/ug as determined by LAL method.
Biological Activity Please contact us for the specific biological activity data.
Product Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Background
N/A.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-CMP337976GMY1(M6)

Recombinant Human Novel Coronavirus Spike glycoprotein(S) (N501Y),partial (Active)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Novel Coronavirus Spike glycoprotein(S) (N501Y),partial (Active)
Copyright © 2021-present Echo Biosystems. All rights reserved.