Recombinant Severe acute respiratory syndrome coronavirus 2 Envelope small membrane protein & Membrane protein(E & M),partial

Specification
Target Name E & M
Uniprot ID P0DTC4 & P0DTC5
Organism Severe acute respiratory syndrome coronavirus 2
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Sequence Desciption Partial
Sequence MYSFVSEETGTLIVNSADSNGTITVEELKKLLEQRINWITGG
Molecular Weight 17.6 kDa
Purity Greater than 90% as determined by SDS-PAGE.
Endotoxin Not test.
Biological Activity Please contact us for the specific biological activity data.
Product Form Lyophilized powder
Buffer Lyophilized from 20 mM Tris-HCl,0.5 M NaCl, 6% Trehalose, pH 8.0
Background
N/A.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$201.00
In stock
SKU
EB-CEP8962GND

Recombinant Severe acute respiratory syndrome coronavirus 2 Envelope small membrane protein & Membrane protein(E & M),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Severe acute respiratory syndrome coronavirus 2 Envelope small membrane protein & Membrane protein(E & M),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.